Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Peptide - N-terminal region

GREB1 Peptide - N-terminal region

Product Specifications

UniProt

Q4ZG55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREB1 Rabbit Polyclonal Antibody (orb587442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Calcitonin (CT) ELISA Kit
YP-W75665-01 48 Tests

Goat Calcitonin (CT) ELISA Kit

Sign In for Pricing
View Details
Goat Calcitonin (CT) ELISA Kit
YP-W75665-02 96 Tests

Goat Calcitonin (CT) ELISA Kit

Sign In for Pricing
View Details
Recombinant Odontella sinensis Probable protein-export membrane protein secG (secG)
orb2936928-01 20 µg

Recombinant Odontella sinensis Probable protein-export membrane protein secG (secG)

Sign In for Pricing
View Details
Recombinant Odontella sinensis Probable protein-export membrane protein secG (secG)
orb2936928-02 100 µg

Recombinant Odontella sinensis Probable protein-export membrane protein secG (secG)

Sign In for Pricing
View Details
Gemin5 (NM_001166671) Mouse Tagged ORF Clone Lentiviral Particle
MR218616L4V 200 µL

Gemin5 (NM_001166671) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FKBPL Antibody
MBS9413866-01 0.05 mL

FKBPL Antibody

Sign In for Pricing
View Details