Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Peptide - N-terminal region

GREB1 Peptide - N-terminal region

Product Specifications

UniProt

Q4ZG55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREB1 Rabbit Polyclonal Antibody (orb587442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eglatoprutug Biosimilar - Research Grade
ICH5510-1mg 1 mg

Eglatoprutug Biosimilar - Research Grade

Sign In for Pricing
View Details
Slc7a5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7591008 1.0 µg DNA

Slc7a5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
1 to 100 ul, filter tips, DNase/RNase free, bulk pack (51mm)
UFPT-F-100B 1000 PCS/Bag - 20 Bags/Case

1 to 100 ul, filter tips, DNase/RNase free, bulk pack (51mm)

Sign In for Pricing
View Details
Human SLC5A12 knockdown cell line
ABC-KD14157 1 Vial

Human SLC5A12 knockdown cell line

Sign In for Pricing
View Details
4-Biphenylacetic acid
C6919-1000 1 g

4-Biphenylacetic acid

Sign In for Pricing
View Details
Z-Asn-OMe
5-07161 1 g

Z-Asn-OMe

Sign In for Pricing
View Details