GTSCR1 Peptide - N-terminal region
GTSCR1 Peptide - N-terminal region
Product Specifications
UniProt
Q86UQ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTSCR1 Rabbit Polyclonal Antibody (orb327001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQVASVTEGEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470198-500 1x 500 µL
Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940495-500 1x 500 µL
SUMO-1 (SM1/495), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details