GUCY1A2 Peptide - N-terminal region
GUCY1A2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GC-SA2, GUC1A2
UniProt
P33402
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GUCY1A2 Rabbit Polyclonal Antibody (orb327002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001243353
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042343-100 1x 100 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![METT10D (METTL16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]](https://cdn.genprice.uk/products/937/6868c367994c49e6dc3f5bbc/imageurl/ta504697bm.webp)
TA504697BM 100 µL
METT10D (METTL16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]
Sign In for Pricing
View Details 
BNC042483-100 1x 100 µL
Peroxiredoxin 4 (Prognostic Marker for Lung SqCC) (CPTC-PRDX4-2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 