Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS2 Peptide - N-terminal region

HAUS2 Peptide - N-terminal region

Product Specifications

UniProt

H3BQU2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS2 Rabbit Polyclonal Antibody (orb327004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEIYQKNLEIELLKLEKDTADVVHPFFLEMKSCYVAQAGLELMASILPFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf80 (ANGPTL8) (NM_018687) Human Tagged ORF Clone Lentiviral Particle
RC218000L3V 200 µL

C19orf80 (ANGPTL8) (NM_018687) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RFPL2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1812404 1.0 µg DNA

RFPL2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Hs1bp3 shRNA (UAS) - Lentiviral mouse Hs1bp3 shRNA (UAS, RFP) plasmid
GTR15294484 1 Vial

Lentiviral mouse Hs1bp3 shRNA (UAS) - Lentiviral mouse Hs1bp3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
OLFR1030 siRNA (Mouse)
MBS8202283-01 15 nmol

OLFR1030 siRNA (Mouse)

Sign In for Pricing
View Details
OLFR1030 siRNA (Mouse)
MBS8202283-02 30 nmol

OLFR1030 siRNA (Mouse)

Sign In for Pricing
View Details
OLFR1030 siRNA (Mouse)
MBS8202283-03 5x 30 nmol

OLFR1030 siRNA (Mouse)

Sign In for Pricing
View Details