Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS2 Peptide - N-terminal region

HAUS2 Peptide - N-terminal region

Product Specifications

UniProt

H3BQU2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS2 Rabbit Polyclonal Antibody (orb327004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEIYQKNLEIELLKLEKDTADVVHPFFLEMKSCYVAQAGLELMASILPFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Alkaline Phosphatase, Tissue Non-Specific Antibody (V17.1) [mFluor Violet 610 SE]
NBP2-47996MFV610 0.1 mL

Mouse Monoclonal Alkaline Phosphatase, Tissue Non-Specific Antibody (V17.1) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Caspase-4 Fluorometric Assay Kit - 25 assays
GWB-AXR085 25 Assays

Caspase-4 Fluorometric Assay Kit - 25 assays

Sign In for Pricing
View Details
SLITRK2 (NM_001144005) Human Tagged ORF Clone
RG227447 10 µg

SLITRK2 (NM_001144005) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human GCNT1 (NM_001097636) AAV Particle
RC224441A1V 250 µL

Human GCNT1 (NM_001097636) AAV Particle

Sign In for Pricing
View Details
Recombinant Edwardsiella ictaluri Small-conductance mechanosensitive channel (mscS)
MBS7021319-01 0.02 mg

Recombinant Edwardsiella ictaluri Small-conductance mechanosensitive channel (mscS)

Sign In for Pricing
View Details
Recombinant Edwardsiella ictaluri Small-conductance mechanosensitive channel (mscS)
MBS7021319-02 0.1 mg

Recombinant Edwardsiella ictaluri Small-conductance mechanosensitive channel (mscS)

Sign In for Pricing
View Details