HEATR3 Peptide - N-terminal region
HEATR3 Peptide - N-terminal region
Product Specifications
UniProt
Q7Z4Q2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HEATR3 Rabbit Polyclonal Antibody (orb587445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_891552
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KECSAGLDSNEMSLQEKKDQNRNSIENIANETVNVLWNICECSSRAVSIF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680690-100 1x 100 µL
TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472961-100 1x 100 µL
C1QB / Complement C1q B-Chain (C1QB/2961), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681634-100 1x 100 µL
P53 Tumor Suppressor Protein (PAb240), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
