Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCN2 Peptide - N-terminal region

HMCN2 Peptide - N-terminal region

Product Specifications

UniProt

H7BZI5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMCN2 Rabbit Polyclonal Antibody (orb587452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pbx 1 shRNA Plasmid (m)
sc-38797-SH 20 µg

Pbx 1 shRNA Plasmid (m)

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody [Clone ID: LBI10D7]
AMM15038V 100 µL

ALK Mouse Monoclonal Antibody [Clone ID: LBI10D7]

Sign In for Pricing
View Details
Muristerone A
2184-1000 1 mg

Muristerone A

Sign In for Pricing
View Details
C-X-C motif chemokine 5 Polyclonal Antibody
orb359770 100 µg

C-X-C motif chemokine 5 Polyclonal Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SEMA3D (Semaphorin 3D)
MP0152J Each

Magic™ Membrane Protein Human SEMA3D (Semaphorin 3D)

Sign In for Pricing
View Details
Mouse Monoclonal LSM3 Antibody (01) [DyLight 488]
NBP3-06568G 0.1 mL

Mouse Monoclonal LSM3 Antibody (01) [DyLight 488]

Sign In for Pricing
View Details