HMCN2 Peptide - N-terminal region
HMCN2 Peptide - N-terminal region
Product Specifications
UniProt
H7BZI5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMCN2 Rabbit Polyclonal Antibody (orb587452) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6204241-01 0.1 mL
ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (MaxLight 490)
Sign In for Pricing
View Details MBS6204241-02 5x 0.1 mL
ZNFN1A5 (Zinc Finger Protein Pegasus, Ikaros Family Zinc Finger Protein 5, IKZF5) (MaxLight 490)
Sign In for Pricing
View Details 