KIAA0355 Peptide - C-terminal region
KIAA0355 Peptide - C-terminal region
Product Specifications
UniProt
O15063
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIAA0355 Rabbit Polyclonal Antibody (orb587482) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055501
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DSASSSDETSSANGDSLFSMFSGPDLVAAVKQRRKHSSGEQDTSTLPSPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details