IQCN Peptide - N-terminal region
IQCN Peptide - N-terminal region
Product Specifications
Product Name Alternative
KIAA1683
UniProt
Q2KHR5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IQCN Rabbit Polyclonal Antibody (orb587491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138776
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLDKMEKAPPQPQHEGLKSKEHLPQQPAEGKTASRRVPRLRAVVESQAFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881547-500 1x 500 µL
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details