Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCN Peptide - N-terminal region

IQCN Peptide - N-terminal region

Product Specifications

Product Name Alternative

KIAA1683

UniProt

Q2KHR5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCN Rabbit Polyclonal Antibody (orb587491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138776

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDKMEKAPPQPQHEGLKSKEHLPQQPAEGKTASRRVPRLRAVVESQAFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ibalizumab Biosimilar - Research Grade
ICH5029-5mg 5 mg

Ibalizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Tsr2 Mouse Gene Knockout Kit (CRISPR)
KN518374 1 Kit

Tsr2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
c-Jun (JUN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA800614AM 100 µL

c-Jun (JUN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

Sign In for Pricing
View Details
GJA4 Antibody
8C15878-AAT 50 µg

GJA4 Antibody

Sign In for Pricing
View Details
Human CTSD (Cathepsin D) ELISA Kit
E-EL-H6269-01 24 Tests

Human CTSD (Cathepsin D) ELISA Kit

Sign In for Pricing
View Details
Human CTSD (Cathepsin D) ELISA Kit
E-EL-H6269-02 48 Tests

Human CTSD (Cathepsin D) ELISA Kit

Sign In for Pricing
View Details