Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRD4 Peptide - N-terminal region

BRD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAP, MCAP, HUNK1, HUNKI

UniProt

O60885

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRD4 Rabbit Polyclonal Antibody (orb574904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055114.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP1BB Polyclonal Antibody
E-AB-90075-01 60 µL

GP1BB Polyclonal Antibody

Sign In for Pricing
View Details
GP1BB Polyclonal Antibody
E-AB-90075-02 120 µL

GP1BB Polyclonal Antibody

Sign In for Pricing
View Details
GP1BB Polyclonal Antibody
E-AB-90075-03 200 µL

GP1BB Polyclonal Antibody

Sign In for Pricing
View Details
CCNA2 Polyclonal Antibody
E-AB-66398-01 60 µL

CCNA2 Polyclonal Antibody

Sign In for Pricing
View Details
CCNA2 Polyclonal Antibody
E-AB-66398-02 120 µL

CCNA2 Polyclonal Antibody

Sign In for Pricing
View Details
CCNA2 Polyclonal Antibody
E-AB-66398-03 200 µL

CCNA2 Polyclonal Antibody

Sign In for Pricing
View Details