Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRD4 Peptide - N-terminal region

BRD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAP, MCAP, HUNK1, HUNKI

UniProt

O60885

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BRD4 Rabbit Polyclonal Antibody (orb574904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055114.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GalNAc b-O-BSA Colloidal Gold Conjugate, 1mL 5nm
CCG-1018-5 1 mL

GalNAc b-O-BSA Colloidal Gold Conjugate, 1mL 5nm

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)
KN416029 1 Kit

Myeloperoxidase (MPO) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Fes activation kit by CRISPRa
GA201387 1 Kit

Mouse Fes activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS808958 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Amplite® Fluorimetric Beta-Hydroxybutyrate (Ketone Body) Assay Kit
13831-AAT 200 Tests

Amplite® Fluorimetric Beta-Hydroxybutyrate (Ketone Body) Assay Kit

Sign In for Pricing
View Details
IL-11RA Mouse Monoclonal Antibody [A6G8]
HA600056 100 µL

IL-11RA Mouse Monoclonal Antibody [A6G8]

Sign In for Pricing
View Details