Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB3 Peptide - middle region

GABRB3 Peptide - middle region

Product Specifications

UniProt

F5H7N0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFL NDKKSFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Resistin-Like α (Retnla) Rat ELISA Kit
G7284 96 Tests

Resistin-Like α (Retnla) Rat ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-CD66c/d Antibody
MBS4505853-01 0.05 mL

Rabbit anti-CD66c/d Antibody

Sign In for Pricing
View Details
Rabbit anti-CD66c/d Antibody
MBS4505853-02 0.1 mL

Rabbit anti-CD66c/d Antibody

Sign In for Pricing
View Details
Rabbit anti-CD66c/d Antibody
MBS4505853-03 5x 0.1 mL

Rabbit anti-CD66c/d Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis UPF0135 protein Mb2255c (Mb2255c)
MBS1106321-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis UPF0135 protein Mb2255c (Mb2255c)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis UPF0135 protein Mb2255c (Mb2255c)
MBS1106321-02 0.02 mg (Yeast)

Recombinant Mycobacterium bovis UPF0135 protein Mb2255c (Mb2255c)

Sign In for Pricing
View Details