Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRB3 Peptide - middle region

GABRB3 Peptide - middle region

Product Specifications

UniProt

F5H7N0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFL NDKKSFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine KalliKrein 1 ELISA Kit
MBS737911-01 48 Well

Canine KalliKrein 1 ELISA Kit

Sign In for Pricing
View Details
Canine KalliKrein 1 ELISA Kit
MBS737911-02 96 Well

Canine KalliKrein 1 ELISA Kit

Sign In for Pricing
View Details
Canine KalliKrein 1 ELISA Kit
MBS737911-03 5x 96 Well

Canine KalliKrein 1 ELISA Kit

Sign In for Pricing
View Details
Canine KalliKrein 1 ELISA Kit
MBS737911-04 10x 96 Well

Canine KalliKrein 1 ELISA Kit

Sign In for Pricing
View Details
TMBIM4 siRNA (Mouse)
CRM7563-01 15 nmol

TMBIM4 siRNA (Mouse)

Sign In for Pricing
View Details
TMBIM4 siRNA (Mouse)
CRM7563-02 30 nmol

TMBIM4 siRNA (Mouse)

Sign In for Pricing
View Details