Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNMB2 Peptide - C-terminal region

KCNMB2 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y691

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNMB2 Rabbit Polyclonal Antibody (orb575531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852006

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iopentol
sc-488480 25 mg

Iopentol

Sign In for Pricing
View Details
IgG, Heavy Chain (MaxLight 490)
MBS6253962-01 0.1 mL

IgG, Heavy Chain (MaxLight 490)

Sign In for Pricing
View Details
IgG, Heavy Chain (MaxLight 490)
MBS6253962-02 5x 0.1 mL

IgG, Heavy Chain (MaxLight 490)

Sign In for Pricing
View Details
C-C Motif Chemokine 3 (CCL3) Antibody (FITC)
abx316102-01 20 µg

C-C Motif Chemokine 3 (CCL3) Antibody (FITC)

Sign In for Pricing
View Details
C-C Motif Chemokine 3 (CCL3) Antibody (FITC)
abx316102-02 50 µg

C-C Motif Chemokine 3 (CCL3) Antibody (FITC)

Sign In for Pricing
View Details
C-C Motif Chemokine 3 (CCL3) Antibody (FITC)
abx316102-03 100 µg

C-C Motif Chemokine 3 (CCL3) Antibody (FITC)

Sign In for Pricing
View Details