Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNMB2 Peptide - C-terminal region

KCNMB2 Peptide - C-terminal region

Product Specifications

UniProt

Q9Y691

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNMB2 Rabbit Polyclonal Antibody (orb575531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852006

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(8Z)-Dodecenyl Acetate
TRC-D525660-1G 1 g

(8Z)-Dodecenyl Acetate

Sign In for Pricing
View Details
Mouse Monoclonal CRIM1 Antibody (MM0202-16G1) [Alexa Fluor 350]
NBP2-12207AF350 0.1 mL

Mouse Monoclonal CRIM1 Antibody (MM0202-16G1) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rabbit anti-TAU Antibody
DL99782A-01 50 µL

Rabbit anti-TAU Antibody

Sign In for Pricing
View Details
Rabbit anti-TAU Antibody
DL99782A-02 100 µL

Rabbit anti-TAU Antibody

Sign In for Pricing
View Details
ISCU Antibody
orb2675675-01 50 µL

ISCU Antibody

Sign In for Pricing
View Details
ISCU Antibody
orb2675675-02 100 µL

ISCU Antibody

Sign In for Pricing
View Details