Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVOL1 Peptide - C-terminal region

OVOL1 Peptide - C-terminal region

Product Specifications

UniProt

Q86XL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OVOL1 Rabbit Polyclonal Antibody (orb575600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS34 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H2]
TA505229AM 100 µL

MRPS34 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H2]

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7) (NM_005556) Human Over-expression Lysate
LC401707 20 µg

Cytokeratin 7 (KRT7) (NM_005556) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708277 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
2-Bromo-9,9-dioctyl Fluorene
TRC-B678860-10MG 10 mg

2-Bromo-9,9-dioctyl Fluorene

Sign In for Pricing
View Details
Benzoyl Peroxide
TRC-B208330-5G 5 g

Benzoyl Peroxide

Sign In for Pricing
View Details
L-Lysine acetate
TRC-L488778-2.5G 2.5 g

L-Lysine acetate

Sign In for Pricing
View Details