Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OVOL1 Peptide - C-terminal region

OVOL1 Peptide - C-terminal region

Product Specifications

UniProt

Q86XL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OVOL1 Rabbit Polyclonal Antibody (orb575600) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EHD4 activation kit by CRISPRa
GA109398 1 Kit

Human EHD4 activation kit by CRISPRa

Sign In for Pricing
View Details
ATP citrate lyase Rabbit Polyclonal Antibody
ER1706-75 100 µL

ATP citrate lyase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IDH3A Human Gene Knockout Kit (CRISPR)
KN200313RB 1 Kit

IDH3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB619155 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
IL20 Receptor alpha (IL20RA) (NM_014432) Human Recombinant Protein
TP762236 50 µg

IL20 Receptor alpha (IL20RA) (NM_014432) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS802802 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details