MCM7 Peptide - N-terminal region
MCM7 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146
UniProt
P33993
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MCM7 Rabbit Polyclonal Antibody (orb576075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_877577
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ZFAND2B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D6]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1a9e/imageurl/ta502515am.webp)
TA502515AM 100 µL
ZFAND2B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D6]
Sign In for Pricing
View Details 
BNUB2480-100 1x 100 µL
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), 0.2mg/mL
Sign In for Pricing
View Details 
BNC943518-500 1x 500 µL
Histone H1 (Pan Nuclear Marker) (rAE-4), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details