Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Peptide - N-terminal region

MCM7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146

UniProt

P33993

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCM7 Rabbit Polyclonal Antibody (orb576075) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_877577

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR562930 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504065 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Lenvatinib-d5
TRC-L329402-5MG 5 mg

Lenvatinib-d5

Sign In for Pricing
View Details
RELB Polyclonal Antibody
E-AB-70221-01 60 µL

RELB Polyclonal Antibody

Sign In for Pricing
View Details
RELB Polyclonal Antibody
E-AB-70221-02 120 µL

RELB Polyclonal Antibody

Sign In for Pricing
View Details
RELB Polyclonal Antibody
E-AB-70221-03 200 µL

RELB Polyclonal Antibody

Sign In for Pricing
View Details