Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOC1S1 Peptide - N-terminal region

BLOC1S1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BLOS1, GCN5L1, MICoA, RT14

UniProt

P78537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BLOC1S1 Rabbit Polyclonal Antibody (orb324750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001478

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMS1 (NM_001289409) Human Tagged ORF Clone
RG239490 10 µg

PMS1 (NM_001289409) Human Tagged ORF Clone

Sign In for Pricing
View Details
PTPLAD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38141064 1.0 µg DNA

PTPLAD1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ZFYVE1 Antibody - N-terminal region : HRP (ARP50842_P050-HRP)
ARP50842_P050-HRP 100 µL

ZFYVE1 Antibody - N-terminal region : HRP (ARP50842_P050-HRP)

Sign In for Pricing
View Details
RPE65 Peptide
MBS544401-01 0.25 mg

RPE65 Peptide

Sign In for Pricing
View Details
RPE65 Peptide
MBS544401-02 5x 0.25 mg

RPE65 Peptide

Sign In for Pricing
View Details
TRIB2 Antibody
R32292 100 µg

TRIB2 Antibody

Sign In for Pricing
View Details