Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLOC1S1 Peptide - N-terminal region

BLOC1S1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BLOS1, GCN5L1, MICoA, RT14

UniProt

P78537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BLOC1S1 Rabbit Polyclonal Antibody (orb324750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001478

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM20 Antibody
E034806 100 µg -100 µL

TOMM20 Antibody

Sign In for Pricing
View Details
TMEM231 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
47017061 1.0 µg DNA

TMEM231 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Bovine Angiotensin I Converting Enzyme 2 ELISA Kit
MBS736578-01 48 Well

Bovine Angiotensin I Converting Enzyme 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiotensin I Converting Enzyme 2 ELISA Kit
MBS736578-02 96 Well

Bovine Angiotensin I Converting Enzyme 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiotensin I Converting Enzyme 2 ELISA Kit
MBS736578-03 5x 96 Well

Bovine Angiotensin I Converting Enzyme 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Angiotensin I Converting Enzyme 2 ELISA Kit
MBS736578-04 10x 96 Well

Bovine Angiotensin I Converting Enzyme 2 ELISA Kit

Sign In for Pricing
View Details