Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELB Peptide - N-terminal region

RELB Peptide - N-terminal region

Product Specifications

Product Name Alternative

IREL, I-REL, REL-B

UniProt

Q01201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RELB Rabbit Polyclonal Antibody (orb576570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006500.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF711 antibody
FNab09733 100 µg

ZNF711 antibody

Sign In for Pricing
View Details
Mouse Folr2 activation kit by CRISPRa
GA201462 1 Kit

Mouse Folr2 activation kit by CRISPRa

Sign In for Pricing
View Details
STK40 Antibody
KC-36741-01 50 μL

STK40 Antibody

Sign In for Pricing
View Details
STK40 Antibody
KC-36741-02 100 µL

STK40 Antibody

Sign In for Pricing
View Details
STK40 Antibody
KC-36741-03 1 mL

STK40 Antibody

Sign In for Pricing
View Details
Mouse Atp6v0d1 activation kit by CRISPRa
GA200334 1 Kit

Mouse Atp6v0d1 activation kit by CRISPRa

Sign In for Pricing
View Details