Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RELB Peptide - N-terminal region

RELB Peptide - N-terminal region

Product Specifications

Product Name Alternative

IREL, I-REL, REL-B

UniProt

Q01201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RELB Rabbit Polyclonal Antibody (orb576570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006500.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMTK3 Human Gene Knockout Kit (CRISPR)
KN223140RB 1 Kit

LMTK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Bromopentane-d11
TRC-B686247-1G 1 g

1-Bromopentane-d11

Sign In for Pricing
View Details
Sptssa Mouse Gene Knockout Kit (CRISPR)
KN516689 1 Kit

Sptssa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody
HA725110 100 µL

Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human IL17 (IL17A) activation kit by CRISPRa
GA102412 1 Kit

Human IL17 (IL17A) activation kit by CRISPRa

Sign In for Pricing
View Details
USP17L3 Human Gene Knockout Kit (CRISPR)
KN432939 1 Kit

USP17L3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details