SMARCB1 Peptide - N-terminal region
SMARCB1 Peptide - N-terminal region
Product Specifications
UniProt
B5MCL5
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMARCB1 Rabbit Polyclonal Antibody (orb576577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA375124 100 µL
Beta crystallin S (CRYGS) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
GAF-451-15 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 15nm
Sign In for Pricing
View Details 
![Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd6a3/imageurl/am39074pu-n.webp)
AM39074PU-N 100 µL
Influenza A H5N1 Mouse Monoclonal Antibody [Clone ID: AT2B7]
Sign In for Pricing
View Details ![CD4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F2]](https://cdn.genprice.uk/products/937/68dd1b75061270361ea1a264/imageurl/ta800528am.webp)
TA800528AM 100 µL
CD4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7F2]
Sign In for Pricing
View Details