HDAC1 Peptide - N-terminal region
HDAC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GON-10, HD1, RPD3, RPD3L1
UniProt
Q13547
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HDAC1 Rabbit Polyclonal Antibody (orb576721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004955
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-1802-40 1 mL
Colloidal Gold Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-E-, 40nm
Sign In for Pricing
View Details ![DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbcfb/imageurl/am06227su-n.webp)
AM06227SU-N 100 µL
DYKDDDDK Epitope Tag Mouse Monoclonal Antibody [Clone ID: 2F11G1]
Sign In for Pricing
View Details 
