Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDAC1 Peptide - N-terminal region

HDAC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GON-10, HD1, RPD3, RPD3L1

UniProt

Q13547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HDAC1 Rabbit Polyclonal Antibody (orb576721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004955

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody
HA723944 100 µL

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MUM1 Recombinant Rabbit Monoclonal Antibody [JE52-60]
ET7110-44 100 µL

MUM1 Recombinant Rabbit Monoclonal Antibody [JE52-60]

Sign In for Pricing
View Details
Psg16 Mouse Gene Knockout Kit (CRISPR)
KN514074 1 Kit

Psg16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FCRL6 Human Gene Knockout Kit (CRISPR)
KN420022 1 Kit

FCRL6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793M-01 25 µg

Elab Fluor® 647 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793M-02 100 µg

Elab Fluor® 647 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details