Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFIC Peptide - N-terminal region

NFIC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CTF, CTF5, NF-I, NFI

UniProt

P08651

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFIC Rabbit Polyclonal Antibody (orb576771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_995315

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CD3 epsilon&CD3 delta Heterodimer Protein, Llama Fc Tag&Llama Fc Tag (MALS verified)
CDD-R5257-100ug 100 µg

Rat CD3 epsilon&CD3 delta Heterodimer Protein, Llama Fc Tag&Llama Fc Tag (MALS verified)

Sign In for Pricing
View Details
SETDB2 Human Gene Knockout Kit (CRISPR)
KN422183 1 Kit

SETDB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LTC4S (NM_145867) Human Recombinant Protein
TP306062L 1 mg

LTC4S (NM_145867) Human Recombinant Protein

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-01 50 μL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-02 100 µL

Tau (S214) Antibody

Sign In for Pricing
View Details
Tau (S214) Antibody
KC-44298-03 1 mL

Tau (S214) Antibody

Sign In for Pricing
View Details