Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFYC Peptide - N-terminal region

NFYC Peptide - N-terminal region

Product Specifications

Product Name Alternative

CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC

UniProt

Q13952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFYC Rabbit Polyclonal Antibody (orb576945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055038

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN303310LP 1 Kit

Chrna7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF740 conjugate, 0.1mg/mL
BNC741654-500 1x 500 µL

CD36 (Platelet & Microvessel Marker) (GPIIIb/1654), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMARCE1 Human Knockdown Lysate
LY300297 100 µg

SMARCE1 Human Knockdown Lysate

Sign In for Pricing
View Details
Human Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit
RDR-SFRP2-Hu-01 96 Tests

Human Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit

Sign In for Pricing
View Details
Human Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit
RDR-SFRP2-Hu-02 48 Tests

Human Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit

Sign In for Pricing
View Details
HBQ1 (NM_005331) Human Recombinant Protein
TP308857M 100 µg

HBQ1 (NM_005331) Human Recombinant Protein

Sign In for Pricing
View Details