Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JADE2 Peptide - N-terminal region

JADE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHF15, JADE-2

UniProt

Q9NQC1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JADE2 Rabbit Polyclonal Antibody (orb324784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001276913.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5T4/TPBG Protein, Mouse, Recombinant (His Tag)
E45M53120M2-100 100 µg

5T4/TPBG Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Rabbit anti-UBE2U Antibody
MBS4504758-01 0.05 mL

Rabbit anti-UBE2U Antibody

Sign In for Pricing
View Details
Rabbit anti-UBE2U Antibody
MBS4504758-02 0.1 mL

Rabbit anti-UBE2U Antibody

Sign In for Pricing
View Details
Rabbit anti-UBE2U Antibody
MBS4504758-03 5x 0.1 mL

Rabbit anti-UBE2U Antibody

Sign In for Pricing
View Details
Anti-Phospho-Akt1 (T72) Antibody
A00024T72 100 µL

Anti-Phospho-Akt1 (T72) Antibody

Sign In for Pricing
View Details
21-Acetoxy-21-deschloro Halobetasol 17-Propionate
421349-01 5 mg

21-Acetoxy-21-deschloro Halobetasol 17-Propionate

Sign In for Pricing
View Details