Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JADE2 Peptide - N-terminal region

JADE2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PHF15, JADE-2

UniProt

Q9NQC1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with JADE2 Rabbit Polyclonal Antibody (orb324784) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001276913.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-8059 miRNA Mimic
MBS8300580-01 5 nmol

hsa-miR-8059 miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-8059 miRNA Mimic
MBS8300580-02 10 nmol

hsa-miR-8059 miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-8059 miRNA Mimic
MBS8300580-03 5x 10 nmol

hsa-miR-8059 miRNA Mimic

Sign In for Pricing
View Details
Trim21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3983707 1.0 µg DNA

Trim21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
5- (Aminomethyl) -N, N-dimethylpyrimidin-2-amine
OR1040320-01 100 mg

5- (Aminomethyl) -N, N-dimethylpyrimidin-2-amine

Sign In for Pricing
View Details
5- (Aminomethyl) -N, N-dimethylpyrimidin-2-amine
OR1040320-02 250 mg

5- (Aminomethyl) -N, N-dimethylpyrimidin-2-amine

Sign In for Pricing
View Details