Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD2 Peptide - C-terminal region

BTBD2 Peptide - C-terminal region

Product Specifications

UniProt

Q9BX70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTBD2 Rabbit Polyclonal Antibody (orb324791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060267

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSV

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG2-set siRNA/shRNA/RNAi Lentivector (Human)
32165091 4x 500 ng

NRG2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-SIRT3 Antibody Picoband®, FITC Conjugate
A01061-3-FITC 100 µg/Vial

Anti-SIRT3 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Acid Violet 17, C.I. discontinued. See 440904
260354-01 10 g

Acid Violet 17, C.I. discontinued. See 440904

Sign In for Pricing
View Details
Acid Violet 17, C.I. discontinued. See 440904
260354-02 25 g

Acid Violet 17, C.I. discontinued. See 440904

Sign In for Pricing
View Details
Acid Violet 17, C.I. discontinued. See 440904
260354-03 50 g

Acid Violet 17, C.I. discontinued. See 440904

Sign In for Pricing
View Details
Acid Violet 17, C.I. discontinued. See 440904
260354-04 100 g

Acid Violet 17, C.I. discontinued. See 440904

Sign In for Pricing
View Details