BTBD2 Peptide - C-terminal region
BTBD2 Peptide - C-terminal region
Product Specifications
UniProt
Q9BX70
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BTBD2 Rabbit Polyclonal Antibody (orb324791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060267
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSV
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1377430-01 0.02 mg (E-Coli)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details MBS1377430-02 0.02 mg (Yeast)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details MBS1377430-03 0.1 mg (E-Coli)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details 
MBS1377430-04 0.1 mg (Yeast)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details 
MBS1377430-05 0.02 mg (Baculovirus)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details MBS1377430-06 0.02 mg (Mammalian-Cell)
Recombinant Helicobacter pylori Urease accessory protein UreH (ureH)
Sign In for Pricing
View Details