Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHSRP Peptide - middle region

KHSRP Peptide - middle region

Product Specifications

Product Name Alternative

FBP2, FUBP2, KSRP

UniProt

Q92945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHSRP Rabbit Polyclonal Antibody (orb577610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003676

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP25-1 CRISPRa sgRNA lentivector (set of three targets)(Human)
26170121 3x 1.0µg DNA

KRTAP25-1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PFKM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36435062 1.0 µg DNA

PFKM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DcR3 (TNFRSF6B) (NM_032945) Human Over-expression Lysate
LH13030V 100 µg

DcR3 (TNFRSF6B) (NM_032945) Human Over-expression Lysate

Sign In for Pricing
View Details
Xpress™ Human C16ORF87 Over-expressing Stable Cell Line
ABC-X0351 1 Vial

Xpress™ Human C16ORF87 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
FBXO28 Over-expression Lysate Product
GWB-8BFC4E 0.1 mg

FBXO28 Over-expression Lysate Product

Sign In for Pricing
View Details
ATG14 Specific Rabbit Polyclonal Antibody
orb394752-01 50 µg

ATG14 Specific Rabbit Polyclonal Antibody

Sign In for Pricing
View Details