Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHSRP Peptide - middle region

KHSRP Peptide - middle region

Product Specifications

Product Name Alternative

FBP2, FUBP2, KSRP

UniProt

Q92945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KHSRP Rabbit Polyclonal Antibody (orb577610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003676

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DCXR Antibody [mFluor Violet 450 SE]
NBP3-00319MFV450 0.1 mL

Rabbit Polyclonal DCXR Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-3 Antibody (rLGALS3/7286) [PE]
NBP3-24178PE 0.1 mL

Mouse Monoclonal Galectin-3 Antibody (rLGALS3/7286) [PE]

Sign In for Pricing
View Details
CD11c Armenian Hamster monoclonal antibody
MB65830-01 50 µL

CD11c Armenian Hamster monoclonal antibody

Sign In for Pricing
View Details
CD11c Armenian Hamster monoclonal antibody
MB65830-02 100 µL

CD11c Armenian Hamster monoclonal antibody

Sign In for Pricing
View Details
CPSF7 Knockout Cell Lysate
ABC-KC0434 100 µg

CPSF7 Knockout Cell Lysate

Sign In for Pricing
View Details
Sheep Breast cancer metastasis suppressor 1 like protein (BRMS1L) ELISA kit
GTR10376947 96 Well

Sheep Breast cancer metastasis suppressor 1 like protein (BRMS1L) ELISA kit

Sign In for Pricing
View Details