RNF149 Peptide - C-terminal region
RNF149 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DNAPTP2
UniProt
Q8NC42
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF149 Rabbit Polyclonal Antibody (orb578841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775918
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-BC-K205-S-01 50 Assays (46 samples)
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
Sign In for Pricing
View Details E-BC-K205-S-02 100 Assays (96 samples)
Low-Density Lipoprotein Cholesterol (LDL-C) Colorimetric Assay Kit (Double Reagents)
Sign In for Pricing
View Details 
BNC040523-500 1x 500 µL
AFP (Alpha Fetoprotein) (C2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Purified Anti-Mouse/Human GAL3 Antibody[M3/38]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d7416/imageurl08/an003440p.webp)