Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNMT3B Peptide - C-terminal region

DNMT3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

ICF, ICF1, M.HsaIIIB

UniProt

Q9UBC3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001193984.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53R2 Antibody
24129 100 µL

P53R2 Antibody

Sign In for Pricing
View Details
PAGE3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1588706 1.0 µg DNA

PAGE3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CD179b Rabbit Polyclonal Antibody
APRab08252-01 20 µL

CD179b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD179b Rabbit Polyclonal Antibody
APRab08252-02 50 µL

CD179b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD179b Rabbit Polyclonal Antibody
APRab08252-03 100 µL

CD179b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD179b Rabbit Polyclonal Antibody
APRab08252-04 200 µL

CD179b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details