Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROSER3 Peptide - N-terminal region

PROSER3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C19orf55

UniProt

Q2NL68

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROSER3 Rabbit Polyclonal Antibody (orb55688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034976.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM3 Polyclonal Antibody
E-AB-15979-01 20 µL

CEACAM3 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM3 Polyclonal Antibody
E-AB-15979-02 60 µL

CEACAM3 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM3 Polyclonal Antibody
E-AB-15979-03 120 µL

CEACAM3 Polyclonal Antibody

Sign In for Pricing
View Details
CEACAM3 Polyclonal Antibody
E-AB-15979-04 200 µL

CEACAM3 Polyclonal Antibody

Sign In for Pricing
View Details
Human OPG Antibody Pair Set
E-KAB-0060 50 µL & 100 µg

Human OPG Antibody Pair Set

Sign In for Pricing
View Details
Human TRIM44 activation kit by CRISPRa
GA110251 1 Kit

Human TRIM44 activation kit by CRISPRa

Sign In for Pricing
View Details