Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROSER3 Peptide - N-terminal region

PROSER3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C19orf55

UniProt

Q2NL68

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PROSER3 Rabbit Polyclonal Antibody (orb55688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034976.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PLK1 (T210) Recombinant Rabbit Monoclonal Antibody [JJ20-58]
ET1701-33 100 µL

Phospho-PLK1 (T210) Recombinant Rabbit Monoclonal Antibody [JJ20-58]

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF594 conjugate, 0.1mg/mL
BNC941059-500 1x 500 µL

CD71 (TFRC/1059), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEMA4B (NM_020210) Human Recombinant Protein
TP316548L 1 mg

SEMA4B (NM_020210) Human Recombinant Protein

Sign In for Pricing
View Details
9130221H12Rik Mouse Gene Knockout Kit (CRISPR)
KN500511 1 Kit

9130221H12Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclaniliprole
TRC-C982490-50MG 50 mg

Cyclaniliprole

Sign In for Pricing
View Details
Mouse IgG (H&L) Antibody Pre-Adsorbed
TA397846 2 mg

Mouse IgG (H&L) Antibody Pre-Adsorbed

Sign In for Pricing
View Details