Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Peptide - N-terminal region

CTTN Peptide - N-terminal region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTTN Rabbit Polyclonal Antibody (orb581558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612632

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TRPV4 Antibody
NBP2-82364-0.1mL 0.1 mL

Rabbit Polyclonal TRPV4 Antibody

Sign In for Pricing
View Details
Interleukin 10 (IL10) BioAssayTM ECL Kit (Human)
366193 96 Tests

Interleukin 10 (IL10) BioAssayTM ECL Kit (Human)

Sign In for Pricing
View Details
MRC2 (NM_006039) Human Untagged Clone
SC303722 10 µg

MRC2 (NM_006039) Human Untagged Clone

Sign In for Pricing
View Details
CD79B Blocking peptide (C terminal region)
AAP80072-100UG 100 µg

CD79B Blocking peptide (C terminal region)

Sign In for Pricing
View Details
MRPS12 AAV Vector (Mouse) (CMV)
30525104 1 µg

MRPS12 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
PLEKHA5 (E-2)
sc-390311 200 µg/mL

PLEKHA5 (E-2)

Sign In for Pricing
View Details