Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Peptide - N-terminal region

CTTN Peptide - N-terminal region

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTTN Rabbit Polyclonal Antibody (orb581558) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612632

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFGEF2 Antibody
MBS8590690-01 0.1 mg

ARFGEF2 Antibody

Sign In for Pricing
View Details
ARFGEF2 Antibody
MBS8590690-02 0.1 mL (AF405L)

ARFGEF2 Antibody

Sign In for Pricing
View Details
ARFGEF2 Antibody
MBS8590690-03 0.1 mL (AF405S)

ARFGEF2 Antibody

Sign In for Pricing
View Details
ARFGEF2 Antibody
MBS8590690-04 0.1 mL (AF610)

ARFGEF2 Antibody

Sign In for Pricing
View Details
ARFGEF2 Antibody
MBS8590690-05 0.1 mL (AF635)

ARFGEF2 Antibody

Sign In for Pricing
View Details
ARFGEF2 Antibody
MBS8590690-06 0.1 mL (APC)

ARFGEF2 Antibody

Sign In for Pricing
View Details