Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT4 Peptide - middle region

ACOT4 Peptide - middle region

Product Specifications

Product Name Alternative

PTE-Ib, PTE1B, PTE2B

UniProt

Q8N9L9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOT4 Rabbit Polyclonal Antibody (orb583985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689544

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NALV GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM92A1 (FAM92A) (NM_145269) Human Recombinant Protein
TP312680M 100 µg

FAM92A1 (FAM92A) (NM_145269) Human Recombinant Protein

Sign In for Pricing
View Details
SNHG32 (NM_001040437) Human Over-expression Lysate
LC421755 20 µg

SNHG32 (NM_001040437) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800328 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), Biotin conjugate, 0.1mg/mL
BNCB2340-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), 0.2mg/mL
BNUB1727-100 1x 100 µL

S100B (Astrocyte and Melanoma Marker), 0.2mg/mL

Sign In for Pricing
View Details
Kawain
TRC-K145700-200MG 200 mg

Kawain

Sign In for Pricing
View Details