ACOT4 Peptide - middle region
ACOT4 Peptide - middle region
Product Specifications
Product Name Alternative
PTE-Ib, PTE1B, PTE2B
UniProt
Q8N9L9
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ACOT4 Rabbit Polyclonal Antibody (orb583985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689544
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NALV GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-BC-F081-01 48 T (32 samples)
Glycerol-3-phosphate (G3P) Fluorometric Assay Kit
Sign In for Pricing
View Details E-BC-F081-02 96 T (80 samples)
Glycerol-3-phosphate (G3P) Fluorometric Assay Kit
Sign In for Pricing
View Details 
BNC941810-100 1x 100 µL
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/1810), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC143117-500 1x 500 µL
CD19 (B-Lymphocyte Marker) (CD19/3117), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-D450135-25MG 25 mg
2-(3,4-Dihydro-2,4-dioxo-1(2H)-quinazolinyl)benzoic Acid
Sign In for Pricing
View Details