Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGB2A1 Peptide - N-terminal region

SCGB2A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LPHC, MGB2, UGB3

UniProt

O75556

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCGB2A1 Rabbit Polyclonal Antibody (orb584654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002398

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR14J1 (C-term) Rabbit Polyclonal Antibody
AP53020PU-N 400 µL

OR14J1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
YAP (Ab-127) Antibody
8B0757-AAT 50 µg

YAP (Ab-127) Antibody

Sign In for Pricing
View Details
FOXN2 Rabbit Polyclonal Antibody
TA376332 100 µL

FOXN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Basic Red 51 (Technical Grade)
TRC-B118740-50MG 50 mg

Basic Red 51 (Technical Grade)

Sign In for Pricing
View Details
Recombinant Mouse IGFBP6/IGFBP-6 Protein (His Tag)
PKSM041045-01 10 µg

Recombinant Mouse IGFBP6/IGFBP-6 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IGFBP6/IGFBP-6 Protein (His Tag)
PKSM041045-02 50 µg

Recombinant Mouse IGFBP6/IGFBP-6 Protein (His Tag)

Sign In for Pricing
View Details