Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCGB2A1 Peptide - N-terminal region

SCGB2A1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

LPHC, MGB2, UGB3

UniProt

O75556

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCGB2A1 Rabbit Polyclonal Antibody (orb584654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002398

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBP1 Antibody
8C10135-AAT 50 µg

HBP1 Antibody

Sign In for Pricing
View Details
Human CNTF Recombinant Rabbit monoclonal Antibody
HA723383B 100 µL

Human CNTF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB501065 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
PKM2 (PKM) Mouse Monoclonal Antibody [Clone ID: AT1B10]
AM50349PU-N 100 µL

PKM2 (PKM) Mouse Monoclonal Antibody [Clone ID: AT1B10]

Sign In for Pricing
View Details
PLK1 (Ab-210) Antibody
8B0554-AAT 50 µg

PLK1 (Ab-210) Antibody

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF488A conjugate, 0.1mg/mL
BNC882387-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details