Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RARRES1 Peptide - middle region

RARRES1 Peptide - middle region

Product Specifications

Product Name Alternative

TIG1

UniProt

P49788

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RARRES1 Rabbit Polyclonal Antibody (orb585111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996846

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRS-1 (phospho Tyr896) Polyclonal Antibody
orb1415191 100 µL

IRS-1 (phospho Tyr896) Polyclonal Antibody

Sign In for Pricing
View Details
KRT19 Protein Vector (Rat) (pPB-C-His)
PV276778 500 ng

KRT19 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Cytokeratin 14 antibody
PAab02197 100 µg

Anti-Cytokeratin 14 antibody

Sign In for Pricing
View Details
Neuropilin-2/NRP2 Monoclonal Antibody (Detector)
MBS2578724-01 0.025 mg

Neuropilin-2/NRP2 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
Neuropilin-2/NRP2 Monoclonal Antibody (Detector)
MBS2578724-02 0.1 mg

Neuropilin-2/NRP2 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details
Neuropilin-2/NRP2 Monoclonal Antibody (Detector)
MBS2578724-03 1 mg

Neuropilin-2/NRP2 Monoclonal Antibody (Detector)

Sign In for Pricing
View Details