RARRES1 Peptide - middle region
RARRES1 Peptide - middle region
Product Specifications
Product Name Alternative
TIG1
UniProt
P49788
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RARRES1 Rabbit Polyclonal Antibody (orb585111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996846
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126776-Biotin 100 µL
FGF19 (Fibroblast Growth Factor 19, FGF-19, UNQ334/PRO533) (Biotin)
Sign In for Pricing
View Details 
orb2933119-01 20 µg
Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial (cox16)
Sign In for Pricing
View Details orb2933119-02 100 µg
Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial (cox16)
Sign In for Pricing
View Details