Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFC Peptide - C-terminal region

PDGFC Peptide - C-terminal region

Product Specifications

UniProt

B4E3A5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDGFC Rabbit Polyclonal Antibody (orb585119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Ethyl-2'-deoxyuridine
TRC-E915020-50MG 50 mg

5-Ethyl-2'-deoxyuridine

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI16D9]
CF809796 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI16D9]

Sign In for Pricing
View Details
3-Benzoylpropanoic Acid
TRC-B208800-5G 5 g

3-Benzoylpropanoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS502643 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Ethyl Acetoacetate
TRC-E899545-50G 50 g

Ethyl Acetoacetate

Sign In for Pricing
View Details
TCF12 Mouse Monoclonal Antibody [Clone ID: OTI4D6G8]
CF809696 100 µg

TCF12 Mouse Monoclonal Antibody [Clone ID: OTI4D6G8]

Sign In for Pricing
View Details